Lineage for d6gopm_ (6gop M:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994876Domain d6gopm_: 6gop M: [355637]
    Other proteins in same PDB: d6gopb_, d6gopc1, d6gopc2, d6gopd_, d6gope_, d6gopf_, d6gopg_, d6gopi_, d6gopj_, d6gopk_, d6gopl_, d6gopn_, d6gopo_, d6gopp_, d6gopq1, d6gopq2, d6gopr_, d6gops_, d6gopt_, d6gopu_, d6gopw_, d6gopx_, d6gopy_, d6gopz_
    automated match to d4j70m_
    complexed with cl, f6k, mg

Details for d6gopm_

PDB Entry: 6gop (more details), 2.9 Å

PDB Description: yeast 20s proteasome in complex with homosalinosporamide a
PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6gopm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gopm_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

SCOPe Domain Coordinates for d6gopm_:

Click to download the PDB-style file with coordinates for d6gopm_.
(The format of our PDB-style files is described here.)

Timeline for d6gopm_: