SCOPe 2.08: Domain d5oahb1: 5oah B:24-310

Lineage for d5oahb1 (5oah B:24-310)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.4: TM0189-like [142789] (4 proteins)
   Part of Pfam PF01497 that include some other superfamily members

6. Protein Enterochelin uptake protein CeuE [142792] (1 species)

7. Species Campylobacter jejuni [TaxId:197] [142793] (11 PDB entries)
   Uniprot Q0P8Q4 44-330

8. Domain d5oahb1: 5oah B:24-310 [355623]
   Other proteins in same PDB: d5oaha2, d5oahb2, d5oahc2
   automated match to d3zkwb_
   complexed with 95b, fe

Details for d5oahb1

PDB Entry: 5oah, 1.8 Å

PDB Description: the periplasmic binding protein ceue of campylobacter jejuni binds the iron(iii) complex of azotochelin

PDB Compounds: (B:) Enterochelin ABC transporter substrate-binding protein

SCOPe Domain Sequences for d5oahb1:

Sequence; same for both SEQRES and ATOM records:

>d5oahb1 c.92.2.4 (B:24-310) Enterochelin uptake protein CeuE {Campylobacter jejuni [TaxId: 197]}
lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk
ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl
ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq
srfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgil
dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk

Timeline for d5oahb1:

• d5oahb1 first appeared in SCOPe 2.07, called d5oahb_