Lineage for d5zaib_ (5zai B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853862Species Metallosphaera sedula [TaxId:399549] [355600] (1 PDB entry)
  8. 2853864Domain d5zaib_: 5zai B: [355618]
    automated match to d2qq3c_
    complexed with coa, edo, gol

Details for d5zaib_

PDB Entry: 5zai (more details), 1.8 Å

PDB Description: crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula
PDB Compounds: (B:) 3-hydroxypropionyl-coenzyme A dehydratase

SCOPe Domain Sequences for d5zaib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zaib_ c.14.1.0 (B:) automated matches {Metallosphaera sedula [TaxId: 399549]}
mefetietkkegnlfwitlnrpdklnalnaklleeldravsqaesdpeirviiitgkgka
fcagaditqfnqltpaeawkfskkgreimdkiealskptiamingyalggglelalacdi
riaaeeaqlglpeinlgiypgyggtqrltrvigkgralemmmtgdripgkdaekyglvnr
vvplanleqetrklaekiakkspislalikevvnrgldspllsglalesvgwgvvfsted
kkegvsaflekreptfk

SCOPe Domain Coordinates for d5zaib_:

Click to download the PDB-style file with coordinates for d5zaib_.
(The format of our PDB-style files is described here.)

Timeline for d5zaib_: