Lineage for d5zqcc_ (5zqc C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (70 species)
    not a true protein
  7. 3055209Species Listeria monocytogenes [TaxId:169963] [355271] (5 PDB entries)
  8. 3055540Domain d5zqcc_: 5zqc C: [355602]
    automated match to d5tr7b_
    complexed with aix, gol

Details for d5zqcc_

PDB Entry: 5zqc (more details), 1.7 Å

PDB Description: crystal structure of penicillin-binding protein d2 from listeria monocytogenes in the ampicillin bound form
PDB Compounds: (C:) Lmo2812 protein

SCOPe Domain Sequences for d5zqcc_:

Sequence, based on SEQRES records: (download)

>d5zqcc_ e.3.1.0 (C:) automated matches {Listeria monocytogenes [TaxId: 169963]}
qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
lmevgfk

Sequence, based on observed residues (ATOM records): (download)

>d5zqcc_ e.3.1.0 (C:) automated matches {Listeria monocytogenes [TaxId: 169963]}
qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
dlvrldavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqakkl
gmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkgakle
stndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdteklme
vgfk

SCOPe Domain Coordinates for d5zqcc_:

Click to download the PDB-style file with coordinates for d5zqcc_.
(The format of our PDB-style files is described here.)

Timeline for d5zqcc_:

  • d5zqcc_ is new in SCOPe 2.07-stable