Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
Species Chicken (Gallus gallus) [TaxId:9031] [53962] (883 PDB entries) Uniprot P00698 |
Domain d6g8ac_: 6g8a C: [355599] automated match to d3lzta_ complexed with cl, edo, na |
PDB Entry: 6g8a (more details), 1.14 Å
SCOPe Domain Sequences for d6g8ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g8ac_ d.2.1.2 (C:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d6g8ac_: