Lineage for d5oa0b_ (5oa0 B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. Protein automated matches [193506] (5 species)
    not a true protein
  7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. Domain d5oa0b_: 5oa0 B: [355597]
    automated match to d2w8gc_
    complexed with edo, nag, sy9; mutant

Details for d5oa0b_

PDB Entry: 5oa0 (more details), 2.6 Å

PDB Description: crystal structure of mutant achbp in complex with strychnine (t53f, q74r, y110a, i135s, w164f)
PDB Compounds: (B:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5oa0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oa0b_ b.96.1.0 (B:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgfflqdivkvdsstnevdlvyyerqrwkl
nslmwdpneygnitdfrtsaadiwtpditaasstrpvqvlspqiavvthdgsvmfspaqr
lsfmcdptgvdseegvtcavkfgsfvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrerragng

SCOPe Domain Coordinates for d5oa0b_ are not available.

Timeline for d5oa0b_:

Domains from other chains:
(mouse over for more information)
d5oa0a_, d5oa0c_, d5oa0d_, d5oa0e_