SCOPe 2.08: Domain d5zh6b_: 5zh6 B:

Lineage for d5zh6b_ (5zh6 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (3 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein automated matches [254433] (3 species)
   not a true protein

7. Species Houndshark (Mustelus griseus) [TaxId:89020] [355591] (2 PDB entries)

8. Domain d5zh6b_: 5zh6 B: [355596]
   automated match to d3fs7a_
   complexed with ca, so4

Details for d5zh6b_

PDB Entry: 5zh6, 1.54 Å

PDB Description: crystal structure of parvalbumin spv-ii of mustelus griseus

PDB Compounds: (B:) Parvalbumin SPV-II

SCOPe Domain Sequences for d5zh6b_:

Sequence; same for both SEQRES and ATOM records:

>d5zh6b_ a.39.1.4 (B:) automated matches {Houndshark (Mustelus griseus) [TaxId: 89020]}
gsittvlnatdiakalaqcagsfnhktffvtsgltnksdanlakvfdildqdrsgfievd
elklflqnfsatareldetetnaflaagdsdhdgkigvdefkamvk

Timeline for d5zh6b_:

• d5zh6b_ first appeared in SCOPe 2.07