SCOPe 2.08: Domain d6cyft1: 6cyf T:1-106

Lineage for d6cyft1 (6cyf T:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6cyft1: 6cyf T:1-106 [355587]
   Other proteins in same PDB: d6cyfc2, d6cyfd_, d6cyfe2, d6cyff_, d6cyfl2, d6cyfm_, d6cyft2, d6cyfu_
   automated match to d1dn0a1

Details for d6cyft1

PDB Entry: 6cyf, 2.78 Å

PDB Description: pcrv fragment with bound fab

PDB Compounds: (T:) IgG1 antibody, kappa light chain

SCOPe Domain Sequences for d6cyft1:

Sequence; same for both SEQRES and ATOM records:

>d6cyft1 b.1.1.0 (T:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aiqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapklliysastlqsgvps
rfsgsgsgtdftltisslqpedfatyyclqdynypwtfgqgtkvei

Timeline for d6cyft1:

• d6cyft1 first appeared in SCOPe 2.07