SCOPe 2.08: Domain d6bhtl2: 6bht L:148-219

Lineage for d6bhtl2 (6bht L:148-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (5 PDB entries)

8. Domain d6bhtl2: 6bht L:148-219 [355572]
   Other proteins in same PDB: d6bhta1, d6bhtb1, d6bhtc1, d6bhtd1, d6bhte1, d6bhtf1, d6bhtg1, d6bhth1, d6bhti1, d6bhtj1, d6bhtk1, d6bhtl1
   automated match to d2m8pa2
   complexed with ihp

Details for d6bhtl2

PDB Entry: 6bht, 2.69 Å

PDB Description: hiv-1 ca hexamer in complex with ip6, orthorhombic crystal form

PDB Compounds: (L:) capsid protein p24

SCOPe Domain Sequences for d6bhtl2:

Sequence, based on SEQRES records:

>d6bhtl2 a.28.3.0 (L:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records):

>d6bhtl2 a.28.3.0 (L:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasnaatetllvqnanpdcktilkaltleemm
tacq

Timeline for d6bhtl2:

• d6bhtl2 first appeared in SCOPe 2.07