Lineage for d5ow8a_ (5ow8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338840Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2338841Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2338846Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2338847Protein Phospholipase A2 [48637] (5 species)
  7. 2338884Species Human (Homo sapiens), SPLA2 [TaxId:9606] [74797] (5 PDB entries)
    group X secretory phospholipase A2
  8. 3055505Domain d5ow8a_: 5ow8 A: [355567]
    automated match to d1le6a_
    complexed with ayn, ca, cl, dms, peg

Details for d5ow8a_

PDB Entry: 5ow8 (more details), 1.9 Å

PDB Description: indole-2 carboxamides as selective secreted phospholipase a2 type x (spla2-x) inhibitors
PDB Compounds: (A:) group 10 secretory phospholipase a2

SCOPe Domain Sequences for d5ow8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ow8a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]}
gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
kcd

SCOPe Domain Coordinates for d5ow8a_:

Click to download the PDB-style file with coordinates for d5ow8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ow8a_:

  • d5ow8a_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-02