Lineage for d5wl2b2 (5wl2 B:110-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750652Domain d5wl2b2: 5wl2 B:110-211 [355565]
    Other proteins in same PDB: d5wl2b1, d5wl2l1
    automated match to d2fb4l2

Details for d5wl2b2

PDB Entry: 5wl2 (more details), 2 Å

PDB Description: vh1-69 germline antibody with cdr h3 sequence of cr9114
PDB Compounds: (B:) Germline-reverted light chain of CR9114

SCOPe Domain Sequences for d5wl2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wl2b2 b.1.1.2 (B:110-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d5wl2b2:

Click to download the PDB-style file with coordinates for d5wl2b2.
(The format of our PDB-style files is described here.)

Timeline for d5wl2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5wl2b1