SCOPe 2.07: Domain d5xnea_: 5xne A:

Lineage for d5xnea_ (5xne A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
   duplication: consists of two similar beta-alpha-beta(4) motifs

4. Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families)
   characteristic metal ion (zinc)-binding motif in the putative active site

5. Family d.290.1.0: automated matches [191426] (1 protein)
   not a true family

6. Protein automated matches [190613] (8 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [355553] (1 PDB entry)

8. Domain d5xnea_: 5xne A: [355554]
   automated match to d1xv2a_
   complexed with zn

Details for d5xnea_

PDB Entry: 5xne, 1.5 Å

PDB Description: x-ray crystal structure of alpha-acetolactate decarboxylase from bacillus subtilis strain 168

PDB Compounds: (A:) alpha-acetolactate decarboxylase

SCOPe Domain Sequences for d5xnea_:

Sequence; same for both SEQRES and ATOM records:

>d5xnea_ d.290.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
vsqiyqvstmtslldgvydgdfelseipkygdfgigtfnkldgeligfdgefyrlrsdgt
atpvqngdrspfcsftfftpdmthkidakmtredfekeinsmlpsrnlfyairidglfkk
vqtrtvelqekpyvpmveavktqpifnfdnvrgtivgfltpayangiavsgyhlhfideg
rnsgghvfdyvledctvtisqkmnmnlrlpntadffnanldnpdfakdiettegs

Timeline for d5xnea_:

• d5xnea_ is new in SCOPe 2.07-stable
  
• d5xnea_ appears in the current release, SCOPe 2.08