Lineage for d5xnea_ (5xne A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009890Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
    duplication: consists of two similar beta-alpha-beta(4) motifs
  4. 3009891Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) (S)
    characteristic metal ion (zinc)-binding motif in the putative active site
  5. 3009917Family d.290.1.0: automated matches [191426] (1 protein)
    not a true family
  6. 3009918Protein automated matches [190613] (9 species)
    not a true protein
  7. 3009919Species Bacillus subtilis [TaxId:224308] [355553] (1 PDB entry)
  8. 3009920Domain d5xnea_: 5xne A: [355554]
    automated match to d1xv2a_
    complexed with zn

Details for d5xnea_

PDB Entry: 5xne (more details), 1.5 Å

PDB Description: x-ray crystal structure of alpha-acetolactate decarboxylase from bacillus subtilis strain 168
PDB Compounds: (A:) alpha-acetolactate decarboxylase

SCOPe Domain Sequences for d5xnea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xnea_ d.290.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 224308]}
vsqiyqvstmtslldgvydgdfelseipkygdfgigtfnkldgeligfdgefyrlrsdgt
atpvqngdrspfcsftfftpdmthkidakmtredfekeinsmlpsrnlfyairidglfkk
vqtrtvelqekpyvpmveavktqpifnfdnvrgtivgfltpayangiavsgyhlhfideg
rnsgghvfdyvledctvtisqkmnmnlrlpntadffnanldnpdfakdiettegs

SCOPe Domain Coordinates for d5xnea_:

Click to download the PDB-style file with coordinates for d5xnea_.
(The format of our PDB-style files is described here.)

Timeline for d5xnea_: