SCOPe 2.08: Domain d6gvva1: 6gvv A:1-470

Lineage for d6gvva1 (6gvv A:1-470)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.0: automated matches [227142] (1 protein)
   not a true family

6. Protein automated matches [226844] (11 species)
   not a true protein

7. Species Foot-and-mouth disease virus - type c [TaxId:12116] [355542] (1 PDB entry)

8. Domain d6gvva1: 6gvv A:1-470 [355543]
   Other proteins in same PDB: d6gvva2
   automated match to d5xe0a_
   complexed with gol; mutant

Details for d6gvva1

PDB Entry: 6gvv, 2.35 Å

PDB Description: mutant m16a of rna dependent rna polymerase 3d from foot-and-mouth disease virus

PDB Compounds: (A:) RNA polymerase 3D

SCOPe Domain Sequences for d6gvva1:

Sequence; same for both SEQRES and ATOM records:

>d6gvva1 e.8.1.0 (A:1-470) automated matches {Foot-and-mouth disease virus - type c [TaxId: 12116]}
glivdtrdveervhvarktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

Timeline for d6gvva1:

• d6gvva1 first appeared in SCOPe 2.07