SCOPe 2.07: Domain d5ogjb_: 5ogj B:

Lineage for d5ogjb_ (5ogj B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein automated matches [190681] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187805] (54 PDB entries)

8. Domain d5ogjb_: 5ogj B: [355524]
   automated match to d3d0na_
   complexed with act, cit, edo, peg, v90, zn

Details for d5ogjb_

PDB Entry: 5ogj, 1.06 Å

PDB Description: crystal structure of human carbonic anhydrase isozyme xiii with 2- (cyclooctylamino)-3,5,6-trifluoro-4-[(2-hydroxyethyl) thio]benzenesulfonamide

PDB Compounds: (B:) Carbonic anhydrase 13

SCOPe Domain Sequences for d5ogjb_:

Sequence; same for both SEQRES and ATOM records:

>d5ogjb_ b.74.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mmsrlswgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssaki
isnsghsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaael
hvvhwnsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftn
fdllsllppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaa
aflvsnhrppqplkgrkvrasfh

Timeline for d5ogjb_:

• d5ogjb_ is new in SCOPe 2.07-stable
  
• d5ogjb_ appears in the current release, SCOPe 2.08