Lineage for d5oaba1 (5oab A:1-127)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. Protein automated matches [190767] (7 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [255211] (6 PDB entries)
  8. Domain d5oaba1: 5oab A:1-127 [355511]
    Other proteins in same PDB: d5oaba2
    automated match to d4x09a_
    complexed with cl, k, na, po4

Details for d5oaba1

PDB Entry: 5oab (more details), 1.11 Å

PDB Description: a novel crystal form of human rnase6 at atomic resolution
PDB Compounds: (A:) Ribonuclease K6

SCOPe Domain Sequences for d5oaba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oaba1 d.5.1.0 (A:1-127) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wpkrltkahwfeiqhiqpsplqcnramsginnytqhckhqntflhdsfqnvaavcdllsi
vcknrrhnchqsskpvnmtdcrltsgkypqcrysaaaqykffivacdppqksdppyklvp
vhldsil

SCOPe Domain Coordinates for d5oaba1 are not available.

Timeline for d5oaba1:

  • d5oaba1 first appeared in SCOPe 2.07, called d5oaba_

Domains from same chain:
(mouse over for more information)
d5oaba2