SCOPe 2.07: Domain d6fn2a1: 6fn2 A:4-207

Lineage for d6fn2a1 (6fn2 A:4-207)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.0: automated matches [227292] (1 protein)
   not a true family

6. Protein automated matches [227113] (4 species)
   not a true protein

7. Species Chlamydomonas reinhardtii [TaxId:3055] [355318] (3 PDB entries)

8. Domain d6fn2a1: 6fn2 A:4-207 [355506]
   Other proteins in same PDB: d6fn2a2
   automated match to d4mlpa1
   complexed with cl, fad, gol, hdf, po4

Details for d6fn2a1

PDB Entry: 6fn2, 2.3 Å

PDB Description: x-ray structure of animal-like cryptochrome from chlamydomonas reinhardtii

PDB Compounds: (A:) Cryptochrome photoreceptor

SCOPe Domain Sequences for d6fn2a1:

Sequence; same for both SEQRES and ATOM records:

>d6fn2a1 c.28.1.0 (A:4-207) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
vknsiiwfrkglrlhdnpalleackdakhvypvfvldphflqqssykvsvnrynfllesl
edlqrsfqargsrllvlrgkpeevfprvfrewgvtqlcfehdtepyakvrdaavrrlaae
agvevvtpishtlydtdmlvarnggaapltmqsftklvdrvgdppapapdppaampppae
dmpsaapaatgvptwqevgfkepp

Timeline for d6fn2a1:

• d6fn2a1 is new in SCOPe 2.07-stable
  
• d6fn2a1 appears in the current release, SCOPe 2.08