Lineage for d6fn2a1 (6fn2 A:4-207)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. Family c.28.1.0: automated matches [227292] (1 protein)
    not a true family
  6. Protein automated matches [227113] (4 species)
    not a true protein
  7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [355318] (3 PDB entries)
  8. Domain d6fn2a1: 6fn2 A:4-207 [355506]
    Other proteins in same PDB: d6fn2a2
    automated match to d4mlpa1
    complexed with cl, fad, gol, hdf, po4

Details for d6fn2a1

PDB Entry: 6fn2 (more details), 2.3 Å

PDB Description: x-ray structure of animal-like cryptochrome from chlamydomonas reinhardtii
PDB Compounds: (A:) Cryptochrome photoreceptor

SCOPe Domain Sequences for d6fn2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fn2a1 c.28.1.0 (A:4-207) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
vknsiiwfrkglrlhdnpalleackdakhvypvfvldphflqqssykvsvnrynfllesl
edlqrsfqargsrllvlrgkpeevfprvfrewgvtqlcfehdtepyakvrdaavrrlaae
agvevvtpishtlydtdmlvarnggaapltmqsftklvdrvgdppapapdppaampppae
dmpsaapaatgvptwqevgfkepp

SCOPe Domain Coordinates for d6fn2a1 are not available.

Timeline for d6fn2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fn2a2