Lineage for d4ecaa_ (4eca A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142623Protein Asparaginase type II [53776] (5 species)
  7. 2142653Species Escherichia coli [TaxId:562] [53777] (7 PDB entries)
  8. 2142656Domain d4ecaa_: 4eca A: [35550]
    mutant

Details for d4ecaa_

PDB Entry: 4eca (more details), 2.2 Å

PDB Description: asparaginase from e. coli, mutant t89v with covalently bound aspartate
PDB Compounds: (A:) l-asparagine amidohydrolase

SCOPe Domain Sequences for d4ecaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ecaa_ c.88.1.1 (A:) Asparaginase type II {Escherichia coli [TaxId: 562]}
lpnitilatggdiagggdsatksnytvgkvgvenlvnavpqlkdianvkgeqvvnigsqd
mndnvwltlakkintdcdktdgfvithgvdtmeetayfldltvkcdkpvvmvgamrpsts
msadgpfnlynavvtaadkasanrgvlvvmndtvldgrdvtktnttdvatfksvnygplg
yihngkidyqrtparkhtsdtpfdvsklnelpkvgivynyanasdlpakalvdagydgiv
sagvgngnlyksvfdtlataaktgtavvrssrvptgattqdaevddakygfvasgtlnpq
karvllqlaltqtkdpqqiqqifnqy

SCOPe Domain Coordinates for d4ecaa_:

Click to download the PDB-style file with coordinates for d4ecaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ecaa_: