Lineage for d1e4ob_ (1e4o B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74884Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
  4. 74885Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (5 families) (S)
  5. 74913Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 74990Protein Maltodextrin phosphorylase (MALP) [53771] (1 species)
  7. 74991Species Escherichia coli [TaxId:562] [53772] (4 PDB entries)
  8. 74997Domain d1e4ob_: 1e4o B: [35549]

Details for d1e4ob_

PDB Entry: 1e4o (more details), 2.9 Å

PDB Description: phosphorylase recognition and phosphorolysis of its oligosaccharide substrate: answers to a long outstanding question

SCOP Domain Sequences for d1e4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ob_ c.87.1.4 (B:) Maltodextrin phosphorylase (MALP) {Escherichia coli}
sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
aeqqginaekltkvlypndnhtagkklrlmqqyfqcacsvadilrrhhlagrklhelady
eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
dqlinlekfaddakfrdqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
drsirdyqariwqakr

SCOP Domain Coordinates for d1e4ob_:

Click to download the PDB-style file with coordinates for d1e4ob_.
(The format of our PDB-style files is described here.)

Timeline for d1e4ob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e4oa_