Lineage for d1e4ob_ (1e4o B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142234Protein Maltodextrin phosphorylase (MALP) [53771] (1 species)
  7. 2142235Species Escherichia coli [TaxId:562] [53772] (7 PDB entries)
  8. 2142247Domain d1e4ob_: 1e4o B: [35549]
    complexed with plp

Details for d1e4ob_

PDB Entry: 1e4o (more details), 2.9 Å

PDB Description: Phosphorylase recognition and phosphorolysis of its oligosaccharide substrate: answers to a long outstanding question
PDB Compounds: (B:) maltodextrin phosphorylase

SCOPe Domain Sequences for d1e4ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4ob_ c.87.1.4 (B:) Maltodextrin phosphorylase (MALP) {Escherichia coli [TaxId: 562]}
sqpifndkqfqealsrqwqryglnsaaemtprqwwlavsealaemlraqpfakpvanqrh
vnyismefligrltgnnllnlgwyqdvqdslkaydinltdlleeeidpalgngglgrlaa
cfldsmatvgqsatgyglnyqyglfrqsfvdgkqveapddwhrsnypwfrhnealdvqvg
iggkvtkdgrwepeftitgqawdlpvvgyrngvaqplrlwqathahpfdltkfndgdflr
aeqqginaekltkvlypndnhtagkklrlmqqyfqcacsvadilrrhhlagrklhelady
eviqlndthptiaipellrvlidehqmswddawaitsktfaytnhtlmpealerwdvklv
kgllprhmqiineintrfktlvektwpgdekvwaklavvhdkqvhmanlcvvggfavngv
aalhsdlvvkdlfpeyhqlwpnkfhnvtngitprrwikqcnpalaalldkslqkewandl
dqlinlekfaddakfrdqyreikqankvrlaefvkvrtgieinpqaifdiqikrlheykr
qhlnllhilalykeirenpqadrvprvflfgakaapgyylakniifainkvadvinndpl
vgdklkvvflpdycvsaaeklipaadiseqistagkeasgtgnmklalngaltvgtldga
nveiaekvgeenififghtveqvkailakgydpvkwrkkdkvldavlkelesgkysdgdk
hafdqmlhsigkqggdpylvmadfaayveaqkqvdvlyrdqeawtraailntarcgmfss
drsirdyqariwqakr

SCOPe Domain Coordinates for d1e4ob_:

Click to download the PDB-style file with coordinates for d1e4ob_.
(The format of our PDB-style files is described here.)

Timeline for d1e4ob_: