Lineage for d6fdyu_ (6fdy U:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (35 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1319 PDB entries)
  8. 3055425Domain d6fdyu_: 6fdy U: [355487]
    automated match to d2ivsa_
    complexed with db8

Details for d6fdyu_

PDB Entry: 6fdy (more details), 1.7 Å

PDB Description: unc-51-like kinase 3 (ulk3) in complex with bosutinib
PDB Compounds: (U:) Serine/threonine-protein kinase ULK3

SCOPe Domain Sequences for d6fdyu_:

Sequence, based on SEQRES records: (download)

>d6fdyu_ d.144.1.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prldgfilterlgsgtyatvykayakkdtrevvaikcvakkslnkasvenllteieilkg
irhphivqlkdfqwdsdniylimefcaggdlsrfihtrrilpekvarvfmqqlasalqfl
hernishldlkpqnillsslekphlkladfgfaqhmspwdekhvlrgsplymapemvcqr
qydarvdlwsmgvilyealfgqppfasrsfseleekirsnrvielplrpllsrdcrdllq
rllerdpsrrisfqdffahpwvdleh

Sequence, based on observed residues (ATOM records): (download)

>d6fdyu_ d.144.1.0 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prldgfilterlgatvykayakkdtrevvaikcvakkslnkasvenllteieilkgirhp
hivqlkdfqwdsdniylimefcaggdlsrfihtrrilpekvarvfmqqlasalqflhern
ishldlkpqnillsslekphlkladfgfaqhmspwdekhvlrgsplymapemvcqrqyda
rvdlwsmgvilyealfgqppfasrsfseleekirsnrvielplrpllsrdcrdllqrlle
rdpsrrisfqdffahpwvdleh

SCOPe Domain Coordinates for d6fdyu_:

Click to download the PDB-style file with coordinates for d6fdyu_.
(The format of our PDB-style files is described here.)

Timeline for d6fdyu_:

  • d6fdyu_ is new in SCOPe 2.07-stable