Lineage for d6g89c_ (6g89 C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (2 families) (S)
    has two smaller insertion domains
  5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (5 proteins)
    automatically mapped to Pfam PF00314
  6. Protein automated matches [190195] (6 species)
    not a true protein
  7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [186982] (31 PDB entries)
  8. Domain d6g89c_: 6g89 C: [355486]
    automated match to d3vjqa_
    complexed with tla

Details for d6g89c_

PDB Entry: 6g89 (more details), 2.36 Å

PDB Description: thaumatin solved by native sad from a dataset collected in 0.6 second with jungfrau detector
PDB Compounds: (C:) thaumatin I

SCOPe Domain Sequences for d6g89c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g89c_ b.25.1.1 (C:) automated matches {Ketemfe (Thaumatococcus daniellii) [TaxId: 4621]}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpt

SCOPe Domain Coordinates for d6g89c_ are not available.

Timeline for d6g89c_: