Lineage for d6fdpa1 (6fdp A:281-395)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2340047Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2340048Protein automated matches [191037] (12 species)
    not a true protein
  7. 2340075Species Human (Homo sapiens) [TaxId:9606] [255451] (14 PDB entries)
  8. 2340091Domain d6fdpa1: 6fdp A:281-395 [355482]
    Other proteins in same PDB: d6fdpa2, d6fdpa3
    automated match to d1elwb_

Details for d6fdpa1

PDB Entry: 6fdp (more details)

PDB Description: nmr structure of the second tpr domain of the human rpap3 protein in complex with hsp90 peptide dtsrmeevd
PDB Compounds: (A:) RNA polymerase II-associated protein 3

SCOPe Domain Sequences for d6fdpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fdpa1 a.118.8.0 (A:281-395) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaisekdrgngffkegkyeraiecytrgiaadganallpanramaylkiqkyeeaekdct
qailldgsyskafarrgtartflgklneakqdfetvlllepgnkqavtelskikk

SCOPe Domain Coordinates for d6fdpa1:

Click to download the PDB-style file with coordinates for d6fdpa1.
(The format of our PDB-style files is described here.)

Timeline for d6fdpa1: