Lineage for d6c0ja1 (6c0j A:-1-429)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2622423Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 2622424Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 2622468Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (204 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2622492Domain d6c0ja1: 6c0j A:-1-429 [355478]
    Other proteins in same PDB: d6c0ja2
    automated match to d2be2a1
    complexed with edo, k5a, mg, so4

Details for d6c0ja1

PDB Entry: 6c0j (more details), 1.92 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with non- nucleoside inhibitor k-5a2
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d6c0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c0ja1 e.8.1.2 (A:-1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdi
viyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
tpplvklwyql

SCOPe Domain Coordinates for d6c0ja1:

Click to download the PDB-style file with coordinates for d6c0ja1.
(The format of our PDB-style files is described here.)

Timeline for d6c0ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6c0ja2
View in 3D
Domains from other chains:
(mouse over for more information)
d6c0jb_