Lineage for d6e5ya2 (6e5y A:190-442)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 proteins)
  6. Protein automated matches [330535] (1 species)
    not a true protein
  7. Species Bordetella pertussis [TaxId:257313] [330536] (2 PDB entries)
  8. Domain d6e5ya2: 6e5y A:190-442 [355477]
    Other proteins in same PDB: d6e5ya1
    automated match to d5us8a2
    complexed with amp, cl, edo, mla, so4

Details for d6e5ya2

PDB Entry: 6e5y (more details), 1.5 Å

PDB Description: 1.50 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis in complex with amp.
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d6e5ya2:

Sequence, based on SEQRES records: (download)

>d6e5ya2 d.210.1.1 (A:190-442) automated matches {Bordetella pertussis [TaxId: 257313]}
aystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeevtvrfeegqpval
ngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapglallfiayerlvt
gihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvaraitgevtlelrrgnd
ysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtreklftyvktgll
apsagsalpqikd

Sequence, based on observed residues (ATOM records): (download)

>d6e5ya2 d.210.1.1 (A:190-442) automated matches {Bordetella pertussis [TaxId: 257313]}
aystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeevtvrfeegqpval
ngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapglallfiayerlvt
gihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvaraitgevtlelrrgnd
ysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtreklftyvktgll
apsalpqikd

SCOPe Domain Coordinates for d6e5ya2 are not available.

Timeline for d6e5ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6e5ya1