Lineage for d6e5ya1 (6e5y A:2-189)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. Protein automated matches [190116] (28 species)
    not a true protein
  7. Species Bordetella pertussis [TaxId:257313] [330533] (2 PDB entries)
  8. Domain d6e5ya1: 6e5y A:2-189 [355476]
    Other proteins in same PDB: d6e5ya2
    automated match to d5us8a1
    complexed with amp, cl, edo, mla, so4

Details for d6e5ya1

PDB Entry: 6e5y (more details), 1.5 Å

PDB Description: 1.50 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis in complex with amp.
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d6e5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e5ya1 c.26.2.0 (A:2-189) automated matches {Bordetella pertussis [TaxId: 257313]}
ttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeiprram
qygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaamked
gvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymrqagf
dykmsaek

SCOPe Domain Coordinates for d6e5ya1 are not available.

Timeline for d6e5ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6e5ya2