Lineage for d6bhtk2 (6bht K:148-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706655Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (5 PDB entries)
  8. 2706668Domain d6bhtk2: 6bht K:148-219 [355443]
    Other proteins in same PDB: d6bhta1, d6bhtb1, d6bhtc1, d6bhtd1, d6bhte1, d6bhtf1, d6bhtg1, d6bhth1, d6bhti1, d6bhtj1, d6bhtk1, d6bhtl1
    automated match to d2m8pa2
    complexed with ihp

Details for d6bhtk2

PDB Entry: 6bht (more details), 2.69 Å

PDB Description: hiv-1 ca hexamer in complex with ip6, orthorhombic crystal form
PDB Compounds: (K:) capsid protein p24

SCOPe Domain Sequences for d6bhtk2:

Sequence, based on SEQRES records: (download)

>d6bhtk2 a.28.3.0 (K:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Sequence, based on observed residues (ATOM records): (download)

>d6bhtk2 a.28.3.0 (K:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqatetllvqnanpdcktilkalgpgatleemm
tacq

SCOPe Domain Coordinates for d6bhtk2:

Click to download the PDB-style file with coordinates for d6bhtk2.
(The format of our PDB-style files is described here.)

Timeline for d6bhtk2: