SCOPe 2.08: Domain d6bhtk1: 6bht K:1-147

Lineage for d6bhtk1 (6bht K:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d6bhtk1: 6bht K:1-147 [355442]
   Other proteins in same PDB: d6bhta2, d6bhtb2, d6bhtc2, d6bhtd2, d6bhte2, d6bhtf2, d6bhtg2, d6bhth2, d6bhti2, d6bhtj2, d6bhtk2, d6bhtl2
   automated match to d4xfxa1
   complexed with ihp

Details for d6bhtk1

PDB Entry: 6bht, 2.69 Å

PDB Description: hiv-1 ca hexamer in complex with ip6, orthorhombic crystal form

PDB Compounds: (K:) capsid protein p24

SCOPe Domain Sequences for d6bhtk1:

Sequence, based on SEQRES records:

>d6bhtk1 a.73.1.1 (K:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d6bhtk1 a.73.1.1 (K:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpmreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmysp

Timeline for d6bhtk1:

• d6bhtk1 first appeared in SCOPe 2.07