Lineage for d6c0ob_ (6c0o B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (203 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. Domain d6c0ob_: 6c0o B: [355431]
    Other proteins in same PDB: d6c0oa2
    automated match to d2hmib_
    complexed with dms, edo, k5c, mg, so4; mutant

Details for d6c0ob_

PDB Entry: 6c0o (more details), 1.9 Å

PDB Description: crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with non-nucleoside inhibitor 25a
PDB Compounds: (B:) Reverse transcriptase P51 SUBUNIT

SCOPe Domain Sequences for d6c0ob_:

Sequence, based on SEQRES records: (download)

>d6c0ob_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
kkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqy
mddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqp
ivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelel
aenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtn
dvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplv
klwyq

Sequence, based on observed residues (ATOM records): (download)

>d6c0ob_ e.8.1.2 (B:) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
kkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdiviyqy
mddlyvgsdleigqhrtkieelrqhllrwgflwmgyelhpdkwtvqpivlpekdswtvnd
iqklvgklnwasqiypgikvrqlskllrgtkalteviplteeaelelaenreilkepvhg
vyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkit
tesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq

SCOPe Domain Coordinates for d6c0ob_ are not available.

Timeline for d6c0ob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6c0oa1, d6c0oa2