SCOPe 2.07: Domain d6c0ka2: 6c0k A:430-554

Lineage for d6c0ka2 (6c0k A:430-554)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11678] [261468] (27 PDB entries)

8. Domain d6c0ka2: 6c0k A:430-554 [355424]
   Other proteins in same PDB: d6c0ka1, d6c0kb_
   automated match to d1dloa1
   complexed with dms, edo, k5a, mg, so4; mutant

Details for d6c0ka2

PDB Entry: 6c0k, 1.96 Å

PDB Description: crystal structure of hiv-1 k103n mutant reverse transcriptase in complex with non-nucleoside inhibitor k-5a2

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d6c0ka2:

Sequence; same for both SEQRES and ATOM records:

>d6c0ka2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d6c0ka2:

• d6c0ka2 is new in SCOPe 2.07-stable
  
• d6c0ka2 appears in the current release, SCOPe 2.08