Lineage for d6c5ta1 (6c5t A:207-477)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2335636Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2335637Species Human (Homo sapiens) [TaxId:9606] [48525] (132 PDB entries)
    Uniprot P37231 232-505
  8. 3055359Domain d6c5ta1: 6c5t A:207-477 [355421]
    Other proteins in same PDB: d6c5ta2
    automated match to d3prga_
    complexed with ekp

Details for d6c5ta1

PDB Entry: 6c5t (more details), 2.75 Å

PDB Description: pparg lbd bound to sr11023
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d6c5ta1:

Sequence, based on SEQRES records: (download)

>d6c5ta1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

Sequence, based on observed residues (ATOM records): (download)

>d6c5ta1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
iqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmla
slmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiavi
ilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvq
llqvikktetdslhpllqeiykdly

SCOPe Domain Coordinates for d6c5ta1:

Click to download the PDB-style file with coordinates for d6c5ta1.
(The format of our PDB-style files is described here.)

Timeline for d6c5ta1:

  • d6c5ta1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-01

View in 3D
Domains from same chain:
(mouse over for more information)
d6c5ta2