Lineage for d6b1ya_ (6b1y A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (70 species)
    not a true protein
  7. 2569882Species Klebsiella pneumoniae [TaxId:573] [225260] (109 PDB entries)
  8. 3055354Domain d6b1ya_: 6b1y A: [355416]
    automated match to d3c5aa_
    complexed with cd7, cl, so4

Details for d6b1ya_

PDB Entry: 6b1y (more details), 1.8 Å

PDB Description: crystal structure kpc-2 beta-lactamase complexed with wck 5153 by co- crystallization
PDB Compounds: (A:) Carbapenem-hydrolyzing beta-lactamase KPC

SCOPe Domain Sequences for d6b1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b1ya_ e.3.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
ataltnlvaepfakleqdfggsigvyamdtgsgatvsyraeerfplcssfkgflaaavla
rsqqqaglldtpirygknalvpwspisekylttgmtvaelsaaavqysdnaaanlllkel
ggpagltafmrsigdttfrldrwelelnsaipgdardtsspravteslqkltlgsalaap
qrqqfvdwlkgnttgnhriraavpadwavgdktgtcgvygtandyavvwptgrapivlav
ytrapnkddkhseaviaaaarlaleglg

SCOPe Domain Coordinates for d6b1ya_:

Click to download the PDB-style file with coordinates for d6b1ya_.
(The format of our PDB-style files is described here.)

Timeline for d6b1ya_:

  • d6b1ya_ is new in SCOPe 2.07-stable