Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
Protein automated matches [191156] (12 species) not a true protein |
Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (5 PDB entries) |
Domain d6bhta2: 6bht A:148-221 [355414] Other proteins in same PDB: d6bhta1, d6bhtb1, d6bhtc1, d6bhtd1, d6bhte1, d6bhtf1, d6bhtg1, d6bhth1, d6bhti1, d6bhtj1, d6bhtk1, d6bhtl1 automated match to d2m8pa2 complexed with ihp |
PDB Entry: 6bht (more details), 2.69 Å
SCOPe Domain Sequences for d6bhta2:
Sequence, based on SEQRES records: (download)
>d6bhta2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]} tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp gatleemmtacqgv
>d6bhta2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]} tsildirqgpkepfrdyvdrfyktlraeqasqenaatetllvqnanpdcktilkalgpga tleemmtacqgv
Timeline for d6bhta2: