Lineage for d6bhta1 (6bht A:1-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717857Protein HIV-1 capsid protein [47945] (1 species)
  7. 2717858Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2717934Domain d6bhta1: 6bht A:1-147 [355413]
    Other proteins in same PDB: d6bhta2, d6bhtb2, d6bhtc2, d6bhtd2, d6bhte2, d6bhtf2, d6bhtg2, d6bhth2, d6bhti2, d6bhtj2, d6bhtk2, d6bhtl2
    automated match to d4xfxa1
    complexed with ihp

Details for d6bhta1

PDB Entry: 6bht (more details), 2.69 Å

PDB Description: hiv-1 ca hexamer in complex with ip6, orthorhombic crystal form
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d6bhta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bhta1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

SCOPe Domain Coordinates for d6bhta1:

Click to download the PDB-style file with coordinates for d6bhta1.
(The format of our PDB-style files is described here.)

Timeline for d6bhta1: