Lineage for d6a8la_ (6a8l A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445599Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445600Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2445653Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2445654Protein automated matches [190499] (25 species)
    not a true protein
  7. 3051495Species Bacillus subtilis [TaxId:1423] [351557] (2 PDB entries)
  8. 3055349Domain d6a8la_: 6a8l A: [355411]
    automated match to d3o94a_
    complexed with zn

Details for d6a8la_

PDB Entry: 6a8l (more details), 2 Å

PDB Description: crystal structure of nicotinamidase/ pyrazinamidase pnca from bacillus subtilis
PDB Compounds: (A:) Isochorismatase

SCOPe Domain Sequences for d6a8la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a8la_ c.33.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mkkalicidytndfaaengaltcgeparqiedtivsltqafiengdyvvfavdshdaddd
fhpetrlfpphningtegkelygrlsplyekhkhaknvnymektrysafagtdlelklre
rqiaelhlaglctdicvlhtavdaynkgfqivihqnavasfnpeghewalshfknsigaq
vae

SCOPe Domain Coordinates for d6a8la_:

Click to download the PDB-style file with coordinates for d6a8la_.
(The format of our PDB-style files is described here.)

Timeline for d6a8la_:

  • d6a8la_ is new in SCOPe 2.07-stable