Lineage for d1ygpa_ (1ygp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142110Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 2142111Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53770] (1 PDB entry)
  8. 2142112Domain d1ygpa_: 1ygp A: [35540]
    complexed with plp, po4

Details for d1ygpa_

PDB Entry: 1ygp (more details), 2.8 Å

PDB Description: phosphorylated form of yeast glycogen phosphorylase with phosphate bound in the active site.
PDB Compounds: (A:) yeast glycogen phosphorylase

SCOPe Domain Sequences for d1ygpa_:

Sequence, based on SEQRES records: (download)

>d1ygpa_ c.87.1.4 (A:) Glycogen phosphorylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
trrltgflpqeiksidtmipllsralwnkhqvkkfnkaedfqdrfidhvettlarslync
ddmvayeaasmsirdnlvidwnktqqkfttrdpkrvyylsleflmgraldnalinmkied
pedpaaskgkpremikgaldelgfkledvldqepdaglgngglgrlaacfvdsmategip
awgyglryeygifaqkiidgyqvetpdywlnsgnpweiernevqipvtfygyvdrpeggk
ttlsasqwiggervlavaydfpvpgfktsnvnnlrlwqarpttefdlnkfnngdyknsva
qqqraesitavlypndnfaqgkelrlkqqyfwcaaslhdilrrfkkskrpwtefpdqvai
qlndthptlaivelqrvlvdlekldwheawdivtktfaytnhtvmqealekwprrlfghl
lprhleiiydinwffledvakkfpkdvdllsrisiieensperqirmaflaivgshkvng
vvelhselikttifkdfikfygpskfvnvtngitprrwlkqanpslaklisetlndptee
ylldmakltqlekyvedkeflkkwnqvklnnkirlvdlikkendgvdiinreylddtlfd
mqvkriheykrqqlnvfgiiyrylamknmlkngasieevarkyprkvsifggksapgyym
akliiklincvadivnndesiehllkvvfvadynvskaeiiipasdlsehistagteasg
tsnmkfvmnggliigtvdganveitreigednvflfgnlsenveelrynhqyhpqdlpss
ldsvlsyiesgqfspenpnefkplvdsikyhgdyylvsddfesylathelvdqefhnqrs
ewlkksvlslanvgffssdrcieeysdtiwnvepvt

Sequence, based on observed residues (ATOM records): (download)

>d1ygpa_ c.87.1.4 (A:) Glycogen phosphorylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
trrltgflpqeiksidtmipllsralwnkhqvkkfnkaedfqdrfidhvettlarslync
ddmvayeaasmsirdnlvidwnktqqkfttrdpkrvyylsleflmgraldnalinmkipr
emikgaldelgfkledvldqepdaglgngglgrlaacfvdsmategipawgyglryeygi
faqkiidgyqvetpdywlnsgnpweiernevqipvtfygyvdrpttlsasqwiggervla
vaydfpvpgfktsnvnnlrlwqarpttefdlnkfnngdyknsvaqqqraesitavlypnd
nfaqgkelrlkqqyfwcaaslhdilrrfkkskrpwtefpdqvaiqlndthptlaivelqr
vlvdlekldwheawdivtktfaytnhtvmqealekwprrlfghllprhleiiydinwffl
edvakkfpkdvdllsrisiieensperqirmaflaivgshkvngvvelhselikttifkd
fikfygpskfvnvtngitprrwlkqanpslaklisetlndpteeylldmakltqlekyve
dkeflkkwnqvklnnkirlvdlikkendgvdiinreylddtlfdmqvkriheykrqqlnv
fgiiyrylamknmlkngasieevarkyprkvsifggksapgyymakliiklincvadivn
ndesiehllkvvfvadynvskaeiiipasdlsehistagteasgtsnmkfvmnggliigt
vdganveitreigednvflfgnlsenveelrynhqyhpqdlpssldsvlsyieqfspenp
nefkplvdsikyhgdyylvsddfesylathelvdqefhnqrsewlkksvlslanvgffss
drcieeysdtiwnvepvt

SCOPe Domain Coordinates for d1ygpa_:

Click to download the PDB-style file with coordinates for d1ygpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ygpa_: