Lineage for d5obah_ (5oba H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2313377Protein automated matches [190041] (30 species)
    not a true protein
  7. 3055125Species Mus musculus [TaxId:10090] [355187] (2 PDB entries)
  8. 3055329Domain d5obah_: 5oba H: [355391]
    Other proteins in same PDB: d5obaf2, d5obag2, d5obal2, d5obar2, d5obas2, d5obav2, d5obax2
    automated match to d5up8a_
    complexed with fe

Details for d5obah_

PDB Entry: 5oba (more details), 2.85 Å

PDB Description: structure of a modified mouse h-chain ferritin with a lanthanide binding motif
PDB Compounds: (H:) ferritin heavy chain

SCOPe Domain Sequences for d5obah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5obah_ a.25.1.1 (H:) automated matches {Mus musculus [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg

SCOPe Domain Coordinates for d5obah_:

Click to download the PDB-style file with coordinates for d5obah_.
(The format of our PDB-style files is described here.)

Timeline for d5obah_:

  • d5obah_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-26