SCOPe 2.07: Domain d5obaf1: 5oba F:4-176

Lineage for d5obaf1 (5oba F:4-176)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [355187] (7 PDB entries)

8. Domain d5obaf1: 5oba F:4-176 [355386]
   Other proteins in same PDB: d5obaf2, d5obag2, d5obal2, d5obar2, d5obas2, d5obav2, d5obax2
   automated match to d5up8a_
   complexed with fe

Details for d5obaf1

PDB Entry: 5oba, 2.85 Å

PDB Description: structure of a modified mouse h-chain ferritin with a lanthanide binding motif

PDB Compounds: (F:) ferritin heavy chain

SCOPe Domain Sequences for d5obaf1:

Sequence; same for both SEQRES and ATOM records:

>d5obaf1 a.25.1.1 (F:4-176) automated matches {Mus musculus [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg

Timeline for d5obaf1:

• d5obaf1 is new in SCOPe 2.07-stable
  
• d5obaf1 appears in the current release, SCOPe 2.08