SCOPe 2.07: Domain d5obbc_: 5obb C:

Lineage for d5obbc_ (5obb C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [355187] (7 PDB entries)

8. Domain d5obbc_: 5obb C: [355366]
   Other proteins in same PDB: d5obba2, d5obbb2, d5obbf2, d5obbg2, d5obbh2, d5obbi2, d5obbj2, d5obbk2, d5obbl2, d5obbm2, d5obbo2, d5obbp2, d5obbq2, d5obbr2, d5obbs2, d5obbt2, d5obbu2, d5obbv2, d5obbw2, d5obbx2
   automated match to d5up8a_
   complexed with tb

Details for d5obbc_

PDB Entry: 5obb, 2.65 Å

PDB Description: structure of a modified mouse h chain ferritin with a lanthanide binding motif in complex with terbium

PDB Compounds: (C:) ferritin heavy chain

SCOPe Domain Sequences for d5obbc_:

Sequence; same for both SEQRES and ATOM records:

>d5obbc_ a.25.1.1 (C:) automated matches {Mus musculus [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg

Timeline for d5obbc_:

• d5obbc_ is new in SCOPe 2.07-stable
  
• d5obbc_ appears in the current release, SCOPe 2.08