Lineage for d5xrsg_ (5xrs G:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2370862Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2370863Protein Hemagglutinin [49824] (18 species)
    includes rudiment esterase domain
  7. 3055193Species Influenza a virus (a/swine/minnesota/a01134337/2010(h3n2)) [TaxId:1159784] [355255] (2 PDB entries)
  8. 3055260Domain d5xrsg_: 5xrs G: [355322]
    Other proteins in same PDB: d5xrsb_, d5xrsd_, d5xrsf_, d5xrsh_
    automated match to d1hgja_
    complexed with bgc, bma, cac, fuc, ful, gal, man, nag, sia

Details for d5xrsg_

PDB Entry: 5xrs (more details), 2.91 Å

PDB Description: crystal structure of a/minnesota/11/2010 (h3n2) influenza virus hemagglutinin in complex with lstc
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d5xrsg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xrsg_ b.19.1.2 (G:) Hemagglutinin {Influenza a virus (a/swine/minnesota/a01134337/2010(h3n2)) [TaxId: 1159784]}
nsmatlclghhavpngtlvktitddqievtnatelvqssstgricnsphqildgknctli
dallgdphcddfqnkewdlfverstaysncypyyvpdyatlrslvassgnleftqesfnw
tgvaqdgssyacrrgsvnsffsrlnwlynlnykypeqnvtmpnndkfdklyiwgvhhpgt
dkdqtnlyvqasgrvivstkrsqqtvipnigsrpwvrgvssiisiywtivkpgdillins
tgnliaprgyfkiqsgkssimrsdahidecnsecitpngsipndkpfqnvnkitygacpr
yvkqntlklatgmrnvpekqt

SCOPe Domain Coordinates for d5xrsg_:

Click to download the PDB-style file with coordinates for d5xrsg_.
(The format of our PDB-style files is described here.)

Timeline for d5xrsg_:

  • d5xrsg_ is new in SCOPe 2.07-stable