Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [355271] (5 PDB entries) |
Domain d5zqed_: 5zqe D: [355302] automated match to d5tr7b_ complexed with ces, gol, peg |
PDB Entry: 5zqe (more details), 2 Å
SCOPe Domain Sequences for d5zqed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zqed_ e.3.1.0 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]} pnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekld lvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqak klgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkgak lestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtekl mevgfk
Timeline for d5zqed_: