Lineage for d5zqed_ (5zqe D:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2619748Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2619749Protein automated matches [190857] (70 species)
    not a true protein
  7. 2620461Species Listeria monocytogenes [TaxId:169963] [355271] (5 PDB entries)
  8. 2620482Domain d5zqed_: 5zqe D: [355302]
    automated match to d5tr7b_
    complexed with ces, gol, peg

Details for d5zqed_

PDB Entry: 5zqe (more details), 2 Å

PDB Description: crystal structure of penicillin-binding protein d2 from listeria monocytogenes in the cefuroxime bound form
PDB Compounds: (D:) Lmo2812 protein

SCOPe Domain Sequences for d5zqed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zqed_ e.3.1.0 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]}
pnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekld
lvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqak
klgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkgak
lestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtekl
mevgfk

SCOPe Domain Coordinates for d5zqed_:

Click to download the PDB-style file with coordinates for d5zqed_.
(The format of our PDB-style files is described here.)

Timeline for d5zqed_: