Lineage for d5zqee_ (5zqe E:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3014129Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 3014130Protein automated matches [190857] (70 species)
    not a true protein
  7. 3014846Species Listeria monocytogenes [TaxId:169963] [355271] (5 PDB entries)
  8. 3014868Domain d5zqee_: 5zqe E: [355293]
    automated match to d5tr7b_
    complexed with ces, gol, peg

Details for d5zqee_

PDB Entry: 5zqe (more details), 2 Å

PDB Description: crystal structure of penicillin-binding protein d2 from listeria monocytogenes in the cefuroxime bound form
PDB Compounds: (E:) Lmo2812 protein

SCOPe Domain Sequences for d5zqee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zqee_ e.3.1.0 (E:) automated matches {Listeria monocytogenes [TaxId: 169963]}
qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
lmevgfk

SCOPe Domain Coordinates for d5zqee_:

Click to download the PDB-style file with coordinates for d5zqee_.
(The format of our PDB-style files is described here.)

Timeline for d5zqee_: