Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Mus musculus [TaxId:10090] [355187] (7 PDB entries) |
Domain d5obbv1: 5obb V:6-176 [355289] Other proteins in same PDB: d5obba2, d5obbb2, d5obbf2, d5obbg2, d5obbh2, d5obbi2, d5obbj2, d5obbk2, d5obbl2, d5obbm2, d5obbo2, d5obbp2, d5obbq2, d5obbr2, d5obbs2, d5obbt2, d5obbu2, d5obbv2, d5obbw2, d5obbx2 automated match to d5up8a_ complexed with tb |
PDB Entry: 5obb (more details), 2.65 Å
SCOPe Domain Sequences for d5obbv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5obbv1 a.25.1.1 (V:6-176) automated matches {Mus musculus [TaxId: 10090]} sqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheereh aeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdkn dphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
Timeline for d5obbv1:
View in 3D Domains from other chains: (mouse over for more information) d5obba1, d5obba2, d5obbb1, d5obbb2, d5obbc_, d5obbd_, d5obbe_, d5obbf1, d5obbf2, d5obbg1, d5obbg2, d5obbh1, d5obbh2, d5obbi1, d5obbi2, d5obbj1, d5obbj2, d5obbk1, d5obbk2, d5obbl1, d5obbl2, d5obbm1, d5obbm2, d5obbn_, d5obbo1, d5obbo2, d5obbp1, d5obbp2, d5obbq1, d5obbq2, d5obbr1, d5obbr2, d5obbs1, d5obbs2, d5obbt1, d5obbt2, d5obbu1, d5obbu2, d5obbw1, d5obbw2, d5obbx1, d5obbx2 |