Lineage for d5z8pa_ (5z8p A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510532Species Striga hermonthica [TaxId:68872] [278337] (16 PDB entries)
  8. 2510536Domain d5z8pa_: 5z8p A: [355284]
    automated match to d5cbka_

Details for d5z8pa_

PDB Entry: 5z8p (more details), 1.35 Å

PDB Description: structural basis for specific inhibition of highly sensitive shhtl7 receptor
PDB Compounds: (A:) Hyposensitive to light 7

SCOPe Domain Sequences for d5z8pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z8pa_ c.69.1.0 (A:) automated matches {Striga hermonthica [TaxId: 68872]}
siglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykvllydhmgagttnpdyf
dfdrysslegysydliaileefqvskciyvghsmssmaaavasifrpdlfhklvmisptp
rlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdlesaamqeycrtlfnmr
pdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavgeylrknlggpsvvevmp
teghlphlsmpevtipvvlrhirqditd

SCOPe Domain Coordinates for d5z8pa_:

Click to download the PDB-style file with coordinates for d5z8pa_.
(The format of our PDB-style files is described here.)

Timeline for d5z8pa_: