Lineage for d5xrsf_ (5xrs F:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 3055212Domain d5xrsf_: 5xrs F: [355274]
    Other proteins in same PDB: d5xrsa_, d5xrsc_, d5xrse_, d5xrsg_
    automated match to d1qfub_
    complexed with bgc, bma, cac, fuc, ful, gal, man, nag, sia

Details for d5xrsf_

PDB Entry: 5xrs (more details), 2.91 Å

PDB Description: crystal structure of a/minnesota/11/2010 (h3n2) influenza virus hemagglutinin in complex with lstc
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d5xrsf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xrsf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfq

SCOPe Domain Coordinates for d5xrsf_:

Click to download the PDB-style file with coordinates for d5xrsf_.
(The format of our PDB-style files is described here.)

Timeline for d5xrsf_:

  • d5xrsf_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-26