Lineage for d9gpbb_ (9gpb B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142109Family c.87.1.4: Oligosaccharide phosphorylase [53766] (3 protein domains)
    automatically mapped to Pfam PF00343
  6. 2142110Protein Glycogen phosphorylase [53767] (3 species)
    both domains are elaborated with many insertions
  7. 2142145Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53769] (74 PDB entries)
    Uniprot P00489 ! Uniprot P00489
  8. 2142223Domain d9gpbb_: 9gpb B: [35525]
    complexed with plp, so4

Details for d9gpbb_

PDB Entry: 9gpb (more details), 2.9 Å

PDB Description: the allosteric transition of glycogen phosphorylase
PDB Compounds: (B:) glycogen phosphorylase b

SCOPe Domain Sequences for d9gpbb_:

Sequence, based on SEQRES records: (download)

>d9gpbb_ c.87.1.4 (B:) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
ndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiir
rfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtv
ktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrms
lveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitpr
rwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayl
ereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggka
apgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqista
gteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaq
eyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsa
lyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap

Sequence, based on observed residues (ATOM records): (download)

>d9gpbb_ c.87.1.4 (B:) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
ndfnlkdfnvggyiqavldrnlaenisrvlypegkelrlkqeyfvvaatlqdiirrfkss
kfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcay
tnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveeg
avkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlvl
cnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereyk
vhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyh
makmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteas
gtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydr
ipelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknp
rewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap

SCOPe Domain Coordinates for d9gpbb_:

Click to download the PDB-style file with coordinates for d9gpbb_.
(The format of our PDB-style files is described here.)

Timeline for d9gpbb_: