SCOPe 2.07: Domain d6cuua1: 6cuu A:4-49,A:173-230

Lineage for d6cuua1 (6cuu A:4-49,A:173-230)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)

6. Protein RNA polymerase alpha [55259] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d6cuua1: 6cuu A:4-49,A:173-230 [355231]
   Other proteins in same PDB: d6cuua2, d6cuub2, d6cuuc_, d6cuud_, d6cuue_, d6cuuf1, d6cuuf2, d6cuuf3
   automated match to d1smya1
   protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn

Details for d6cuua1

PDB Entry: 6cuu, 2.99 Å

PDB Description: thermus thermophiles rna polymerase in complex with promoter dna and antibiotic kanglemycin a

PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d6cuua1:

Sequence; same for both SEQRES and ATOM records:

>d6cuua1 d.74.3.1 (A:4-49,A:173-230) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
sklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtr
lgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqa

Timeline for d6cuua1:

• d6cuua1 is new in SCOPe 2.07-stable
  
• d6cuua1 appears in the current release, SCOPe 2.08