Lineage for d5xrtf_ (5xrt F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041404Domain d5xrtf_: 5xrt F: [355227]
    Other proteins in same PDB: d5xrta_, d5xrtc_, d5xrte_, d5xrtg_
    automated match to d1qfub_
    complexed with cac, nag

Details for d5xrtf_

PDB Entry: 5xrt (more details), 3.15 Å

PDB Description: crystal structure of a/minnesota/11/2010 (h3n2) influenza virus hemagglutinin
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d5xrtf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xrtf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqitgklnrvikktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemsklfe
rtrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdiyrnealnnrfqik

SCOPe Domain Coordinates for d5xrtf_:

Click to download the PDB-style file with coordinates for d5xrtf_.
(The format of our PDB-style files is described here.)

Timeline for d5xrtf_: