Lineage for d7gpbb_ (7gpb B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27778Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
  4. 27779Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (4 families) (S)
  5. 27801Family c.87.1.4: Oligosaccharide phosphorylase [53766] (2 proteins)
  6. 27802Protein Glycogen phosphorylase [53767] (3 species)
  7. 27814Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53769] (44 PDB entries)
  8. 27858Domain d7gpbb_: 7gpb B: [35521]

Details for d7gpbb_

PDB Entry: 7gpb (more details), 2.9 Å

PDB Description: structural mechanism for glycogen phosphorylase control by phosphorylation and amp

SCOP Domain Sequences for d7gpbb_:

Sequence, based on SEQRES records: (download)

>d7gpbb_ c.87.1.4 (B:) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus)}
rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
ndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiir
rfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtv
ktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrms
lveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitpr
rwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaayl
ereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggka
apgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqista
gteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaq
eyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsa
lyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap

Sequence, based on observed residues (ATOM records): (download)

>d7gpbb_ c.87.1.4 (B:) Glycogen phosphorylase {Rabbit (Oryctolagus cuniculus)}
rkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwir
tqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieeda
glgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpw
ekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakap
ndfnlkdfnvggyiqavldrnlaenisrvlypnegkelrlkqeyfvvaatlqdiirrfks
skfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktca
ytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslvee
gavkrinmahlciagshavngvarihseilkktifkdfyelephkfqnktngitprrwlv
lcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylerey
kvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgy
hmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagtea
sgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyyd
ripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalykn
prewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpap

SCOP Domain Coordinates for d7gpbb_:

Click to download the PDB-style file with coordinates for d7gpbb_.
(The format of our PDB-style files is described here.)

Timeline for d7gpbb_: